AttributeError: module 'deepspeed' has no attribute 'comm'

[YvetteJxy]

When I run the example given in readme:

model = esm.pretrained.esmfold_v1()
model = model.eval().cuda()
model.set_chunk_size(128)
sequence = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"
with torch.no_grad():
output = model.infer_pdb(sequence)

I have encountered an error : module 'deepspeed' has no attribute 'comm'. And this error originated from 'output = model.infer_pdb(sequence)' .

I am very confused why this problem happens and do not know what to do.

[awer-A]

Please tell me if you solved this error

[YvetteJxy]

@awer-A Maybe you can try to update the deepspeed version to 0.7.0. and I hope it will work.
If you have any other questions, please let me know.

[awer-A]

@YvetteJxy Thank you very much for your reply. Now it can run successfully,But the pLDDT result I obtained is 49.75926877470356. Do you know what could be the reason?